{"title":"Preorders Book 06\/20\/2026","description":"","products":[{"product_id":"batman-gargoyle-of-gotham-the-deluxe-edition-hardcover","title":"BATMAN: GARGOYLE OF GOTHAM THE DELUXE EDITION HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W\/A) Rafael Grampa\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eWhen you case your own shadow…it leads you into the abyss.\u003cbr\u003eBatman knows intimately even the darkest and most irredeemable streets of Gotham City, but when an all-new rogues gallery of depraved villains emerges from its murky depths, he will come to find that he hardly knows himself. A serial killer is on the loose, and while the murder victims seem random at first, every clue draws Batman closer to the terrifying truth—that they are all connected, not just to each other…but to him. Batman will have to contend with the very nature of evil—including that which lurks inside in the darkest corners of his own heart—to face what’s coming for his city.\u003c\/p\u003e\n\u003cp\u003eBatman: Gargoyle of Gotham brings Eisner Award-winning creator Rafael Grampá’s twisted vision of both the Dark Knight and Gotham City to life in this thrilling deluxe edition that will reach its icy black tendrils into the rotting heart of human nature and leave you gasping for breath—and for more!\u003c\/p\u003e\n\u003cp\u003eCollects Batman: Gargoyle of Gotham #1-4.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\/20\/2026\u003cbr\u003eIn-Store Date:    09\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781799501176\u003c\/span\u003e\u003cbr\u003ePage Count:    232\u003c\/p\u003e","brand":"DC Comics","offers":[{"title":"Default Title","offer_id":47634464571557,"sku":null,"price":45.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/BATMANGARGOYLEOFGOTHAMTHEDELUXEEDITIONHARDCOVER.jpg?v=1773933416"},{"product_id":"batman-hush-2-hardcover","title":"BATMAN HUSH 2 HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Jeph Loeb (A\/CA) Jim Lee, Scott Williams\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eTwo legendary creators, one incredible story! Jeph Loeb and Jim Lee return to the Batman saga that changed the Dark Knight forever with the sequel to the original Hush, H2SH!\u003cbr\u003eA mysterious villain from Batman’s past has returned, leaving the Dark Knight’s world upended. Now he must use ever resource and every tool in his belt to save both his city and himself. From the legendary creators Jeph Loeb and Jim Lee, the sequel to the original Hush saga has finally arrived, heralding a new age for Gotham and everyone who lives there.\u003cbr\u003eCollects Batman #158-163\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\/20\/2026\u003cbr\u003eIn-Store Date:    09\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781799505464\u003c\/span\u003e\u003cbr\u003ePage Count:    176\u003c\/p\u003e","brand":"DC Comics","offers":[{"title":"Default Title","offer_id":47635054231717,"sku":null,"price":39.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/BATMANHUSH2HARDCOVER.jpg?v=1773955189"},{"product_id":"lucky-devils-hardcover","title":"LUCKY DEVILS HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Charles Soule (A\/CA) Ryan Browne\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eA dark, hilarious satire about the struggle to do good in a world that makes it so easy to be bad, THE LUCKY DEVILS is an examination of everything that makes humanity both grand and terrible from two of comics' most unique storytellers. THE LUCKY DEVILS is a tale of two ordinary, good-hearted, 20-something Chicagoans who begin working with the devils on their shoulders in an attempt to fix their broken lives. It works beyond their wildest dreams, and in time they become two of the most powerful people on earth. While they fully intend to use that influence to make the world a better place, we all know what they say about the road to Hell… For fans of their previous bestselling collaborations like CURSE WORDS and EIGHT BILLION GENIES, stories like Lucifer or The Good Place, or tales where ordinary people's lives intersect with the supernatural—this new series is sure to delight readers looking for a fantastical new read. Collects THE LUCKY DEVILS #1-9.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781534331228\u003c\/span\u003e\u003cbr\u003ePage Count:    246\u003c\/p\u003e","brand":"Image Comics","offers":[{"title":"Default Title","offer_id":47657608282277,"sku":null,"price":53.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/LUCKYDEVILS.jpg?v=1774555938"},{"product_id":"vampirella-armageddon-vol-01-trade-paperback","title":"VAMPIRELLA ARMAGEDDON VOL 01 TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Thomas Sniegoski (A) Kewber Baal (CA) Joseph Michael Linsner\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eTHE COUNTDOWN TO DESTRUCTION BEGINS! Return to the future world of Sepulcher City in Vampirella: Armageddon, from the masterfully mesmerizing creative team of writer TOM SNIEGOSKI and artist KEWBER BAAL! Picking up where Sniegoski’s most recent Vampirella Strikes! series left off, Armageddon opens with the Daughter of Drakulon beset on all sides by the forces of Chaos, even as a new threat arrives to add to her troubles — a threat that is not of this mortal plane!\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\/20\/2026\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781524129217\u003c\/span\u003e\u003cbr\u003ePage Count:    144\u003c\/p\u003e","brand":"DYNAMITE Entertainment","offers":[{"title":"Default Title","offer_id":47682693922981,"sku":null,"price":27.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/VAMPIRELLAARMAGEDDONTPVOL01.jpg?v=1775154225"},{"product_id":"department-of-truth-vol-07-trade-paperback","title":"DEPARTMENT OF TRUTH VOL 07 TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) James Tynion IV, Scott Snyder (A) Martin Simmonds, Ben Templesmith, Joshua Hixson, Jordie Bellaire (CA) Martin Simmonds\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eA new day has dawned at the Department of Truth. Lee Harvey Oswald and his ruthless new recruits are ready to do whatever it takes to make the agency great again. Now, Cole Turner is on the run—and he may have nowhere left to turn except for Black Hat, the counter-agency that’s been trying to recruit him since the very beginning… ALSO IN THIS VOLUME: critically acclaimed artist Ben Templesmith (30 Days of Night) joins the series to reveal the shockingly primeval origin of gun-toting, Bible-quoting new agent Charity Sinclair. And legendary creators Scott Snyder (Absolute Batman) and Joshua Hixson (The Deviant) explore who--or what--was Elvis Presley? Collects issues #0 \u0026amp; #34-38, including \"Suspicious Minds\"\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\/20\/2026\u003cbr\u003eIn-Store Date:    08\/26\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781534332010\u003c\/span\u003e\u003cbr\u003ePage Count:    152\u003c\/p\u003e","brand":"Image Comics","offers":[{"title":"Default Title","offer_id":47682702606501,"sku":null,"price":22.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/DEPARTMENTOFTRUTHTPVOL07.jpg?v=1775154993"},{"product_id":"magic-the-gathering-untold-stories-elspeth-trade-paperback-1","title":"MAGIC THE GATHERING UNTOLD STORIES ELSPETH TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Dan Watters (A) Owen Gieni, Hilary Jenkins, Clayton Cowles\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eWitness Planeswalker Elspeth Tirel’s escape from the underworld and her battle against her god in this first graphic novel collection of Dark Horse Comic’s tales from Magic the Gathering’s multiverse.\u003c\/p\u003e\n\u003cp\u003eElspeth is dead. But her story is not yet over.\u003cbr\u003eThe sun god Heliod, having grown envious of his champion, struck her down to the underworld. There, she is forced to relive the worst moments of her life for all eternity. But Elspeth does not submit to despair—she emerges from each conflict a greater hero than before. And for a great hero like Elspeth, what is death but another challenge to overcome?\u003c\/p\u003e\n\u003cp\u003eThe unpublished story of Theros Beyond Death is finally brought to life by renowned author Dan Watters and talented artist Owen Gieni.\u003c\/p\u003e\n\u003cp\u003eCollects Magic: The Gathering: Untold Stories—Elspeth #1–#4.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506749761\u003c\/span\u003e\u003cbr\u003ePage Count:    112\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47688272248997,"sku":null,"price":25.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/MAGICTHEGATHERINGUNTOLDSTORIESELSPETHTRADEPAPERBACK.jpg?v=1775319006"},{"product_id":"green-hornet-miss-fury-trade-paperback","title":"GREEN HORNET MISS FURY TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Alex Segura (A) Federico Sorressa (CA) Jae Lee\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eWhen Marla Drake and Britt Reid meet, sparks fly – and it’s not just because of the bullets ricocheting around them! As their alter egos Miss Fury and The Green Hornet, the two vigilantes have very different styles of crimefighting. But when they both turn up to investigate the murder of beloved professor Javier Mercado, they soon discover that they have more in common than they realized: Mercado was a mentor to both of them at different times, back when he too led a double life as the Silver Shrike. With each having a personal stake in finding Mercado’s killer, Drake and Reid must learn how to work together to solve the case if they don’t want to end up sabotaging each other’s efforts. But there’s another, even more compelling reason to join forces: Whoever killed the Silver Shrike is going after other heroes, past and present — and at the top of that list are Miss Fury and the Green Hornet! Award-winning author ALEX SEGURA (Star Wars, Secret Identity) and rising star artist FEDERICO SORRESSA kick off the action in the finest noir tradition in The Green Hornet\/Miss Fury!\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781524127497\u003c\/span\u003e\u003cbr\u003ePage Count:    128\u003c\/p\u003e","brand":"DYNAMITE Entertainment","offers":[{"title":"Default Title","offer_id":47859555860645,"sku":null,"price":27.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/GREENHORNETMISSFURYTP.jpg?v=1779907534"},{"product_id":"harley-quinn-x-elvira-hardcover","title":"HARLEY QUINN X ELVIRA HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Amanda Conner, Jimmy Palmiotti (A) Amanda Conner, Juan Samu (CA) Amanda Conner\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eTHE MISTRESS OF THE DARK MEETS DADDY’S LITTLE MONSTER! What happens when the Clown Princess of Crime gets bored? Shenanigans, hijinks, grievous bodily harm… the possibilities are endless! Now add in a certain macabre-minded TV host who seems to attract trouble like crypts attract vampires, and the stage is set for the greatest team-up since Frankenstein met his Bride! With her beloved show on the chopping block following a corporate takeover, Elvira needs to come up with a plan to get things back in the black — and her new friend Harley Quinn has an idea that’s just crazy enough to work! Together, they’re going to throw the greatest Halloween party Brooklyn has ever seen — whether the borough likes it or not! Written by AMANDA CONNER and JIMMY PALMIOTTI — the world-famous tag-team of all things Harley Quinn — this crossover event for the ages from Dynamite and DC Comics also showcases Amanda’s fan-favorite artistic chops, with each issue featuring two (count ’em, two) Conner covers. And that’s not all (certainly not!) — she’s also joining interior artist (and Elvira favorite) JUAN SAMU to provide selected story pages for the series!\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781524129347\u003c\/span\u003e\u003cbr\u003ePage Count:    144\u003c\/p\u003e","brand":"DYNAMITE Entertainment","offers":[{"title":"Default Title","offer_id":47859567755429,"sku":null,"price":34.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/HARLEYQUINNXELVIRA.jpg?v=1779907707"},{"product_id":"harley-quinn-x-elvira-trade-paperback","title":"HARLEY QUINN X ELVIRA TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Amanda Conner, Jimmy Palmiotti (A) Amanda Conner, Juan Samu (CA) Amanda Conner\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eTHE MISTRESS OF THE DARK MEETS DADDY’S LITTLE MONSTER! What happens when the Clown Princess of Crime gets bored? Shenanigans, hijinks, grievous bodily harm… the possibilities are endless! Now add in a certain macabre-minded TV host who seems to attract trouble like crypts attract vampires, and the stage is set for the greatest team-up since Frankenstein met his Bride! With her beloved show on the chopping block following a corporate takeover, Elvira needs to come up with a plan to get things back in the black — and her new friend Harley Quinn has an idea that’s just crazy enough to work! Together, they’re going to throw the greatest Halloween party Brooklyn has ever seen — whether the borough likes it or not! Written by AMANDA CONNER and JIMMY PALMIOTTI — the world-famous tag-team of all things Harley Quinn — this crossover event for the ages from Dynamite and DC Comics also showcases Amanda’s fan-favorite artistic chops, with each issue featuring two (count ’em, two) Conner covers. And that’s not all (certainly not!) — she’s also joining interior artist (and Elvira favorite) JUAN SAMU to provide selected story pages for the series!\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781524129330\u003c\/span\u003e\u003cbr\u003ePage Count:    144\u003c\/p\u003e","brand":"DYNAMITE Entertainment","offers":[{"title":"Default Title","offer_id":47859569754277,"sku":null,"price":27.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/HARLEYQUINNXELVIRA.jpg?v=1779907707"},{"product_id":"peter-cannon-thunderbolt-destroyer-of-death-trade-paperback","title":"PETER CANNON THUNDERBOLT DESTROYER OF DEATH TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Fred Van Lente (A\/CA) Jonathan Lau\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003ePETER CANNON IS BACK — AND FISTS AND FEET WILL FLY! Dynamite’s millionaire martial artist returns in this all-new action-packed reimagining from enlightened author FRED VAN LENTE (Die!namite) and ascended artist JONATHAN LAU (Space Ghost)! As a child, Peter Cannon grew up in the secluded culture of “The Awakened,” a isolated movement blending New Age psychology, Tibetan Buddhism, extreme fitness, and other esoteric disciplines. But when a mass suicide wiped out almost all of the Awakened’s followers, an orphaned and abandoned Peter was left to find his own way in the world. Now, years later, the last surviving member of a mysterious mystical order arrives in New York City on a mission of revenge. His target? The renegade master who destroyed his clan — Peter Cannon! But taking out the fabled Lightning Vessel of the Awakened is easier said than done — especially considering that Cannon’s mind-and-body-perfected moves can collapse time and defy death itself!\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781524129309\u003c\/span\u003e\u003cbr\u003ePage Count:    96\u003c\/p\u003e","brand":"DYNAMITE Entertainment","offers":[{"title":"Default Title","offer_id":47859638567077,"sku":null,"price":24.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/PETERCANNONTHUNDERBOLTDESTROYEROFDEATHTP.jpg?v=1779908566"},{"product_id":"deviant-deluxe-edition-joshua-hixson-cvr-hardcover","title":"DEVIANT DELUXE EDITION JOSHUA HIXSON CVR HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) James Tynion IV (A\/CA) Joshua Hixson\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eEISNER NOMINATED FOR BEST LIMITED SERIES! Hannibal meets Silent Night, Deadly Night in this pitch-black holiday horror story that cuts right through our most unspoken cultural taboos. As snow falls over Milwaukee in 1972, a blood-stained Santa Claus commits unimaginable atrocities against young men. Fifty years later, a troubled young writer interviews this so-called \"Deviant Killer,\" who still maintains his innocence from behind bars. And as Christmas approaches once again, the past returns, wielding a sharpened ax. Eisner-winning writer JAMES TYNION IV (THE DEPARTMENT OF TRUTH, EXQUISITE CORPSES) and acclaimed artist JOSHUA HIXSON (SHANGHAI RED, Absolute Batman, The Plot) unite for a psychological crime thriller that explores the intersection of queer identities and a broader scope of cultural transgression and deviance. This deluxe hardcover edition collects the entire nine-issue series, along with a cover gallery and exclusive developmental material to offer readers a never-before-seen look behind the mask. Collects THE DEVIANT #1-9\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781534334748\u003c\/span\u003e\u003cbr\u003ePage Count:    312\u003c\/p\u003e","brand":"Image Comics","offers":[{"title":"Default Title","offer_id":47859728351397,"sku":null,"price":69.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/DEVIANTDELUXEEDITIONJOSHUAHIXSONCVRHARDCOVER.jpg?v=1779911385"},{"product_id":"deviant-deluxe-edition-direct-market-exclusive-joshua-hixson-cvr-hardcover-copy","title":"DEVIANT DELUXE EDITION DIRECT MARKET EXCLUSIVE JOSHUA HIXSON CVR HARDCOVER (Copy)","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) James Tynion IV (A\/CA) Joshua Hixson\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eEISNER NOMINATED FOR BEST LIMITED SERIES! Hannibal meets Silent Night, Deadly Night in this pitch-black holiday horror story that cuts right through our most unspoken cultural taboos. As snow falls over Milwaukee in 1972, a blood-stained Santa Claus commits unimaginable atrocities against young men. Fifty years later, a troubled young writer interviews this so-called \"Deviant Killer,\" who still maintains his innocence from behind bars. And as Christmas approaches once again, the past returns, wielding a sharpened ax. Eisner-winning writer JAMES TYNION IV (THE DEPARTMENT OF TRUTH, EXQUISITE CORPSES) and acclaimed artist JOSHUA HIXSON (SHANGHAI RED, Absolute Batman, The Plot) unite for a psychological crime thriller that explores the intersection of queer identities and a broader scope of cultural transgression and deviance. This deluxe hardcover edition collects the entire nine-issue series, along with a cover gallery and exclusive developmental material to offer readers a never-before-seen look behind the mask. Collects THE DEVIANT #1-9\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781534353930\u003c\/span\u003e\u003cbr\u003ePage Count:    312\u003c\/p\u003e","brand":"Image Comics","offers":[{"title":"Default Title","offer_id":47859729957029,"sku":null,"price":69.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/No_Cover_Available_3f0301e4-1503-4d8a-af1d-e1c01b8661af.jpg?v=1771510017"},{"product_id":"hyde-street-vol-02-trade-paperback","title":"HYDE STREET VOL 02 TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Geoff Johns (A) Ivan Reis, Francis Portela, Danny Miki, Brad Anderson (CA) Ivan Reis, Danny Miki, Brad Anderson\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eHYDE STREET ISN’T SAFE FOR ANYONE—INCLUDING ITS RESIDENT GHOULS, PSYCHOS, AND KILLERS! When Pranky steals a cursed werewolf mask from his Hyde Street nemesis Mr. X-Ray, the world’s most dangerous scout finds himself transformed into a pint-sized wolf-kid. Unable to remove it from his face, a humbled Pranky must ask for help from X-Ray and the neighborhood’s sinister surgeon Doctor Ego. But none of them or the other residents are prepared for what’s stalking them from the shadows: The Butcher of Hyde Street has escaped imprisonment, stalks his fellow Residents, and basks in their blood. Collects HYDE STREET #8-12\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/29\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781534333628\u003c\/span\u003e\u003cbr\u003ePage Count:    128\u003c\/p\u003e","brand":"Image Comics","offers":[{"title":"Default Title","offer_id":47859743555749,"sku":null,"price":19.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/HYDESTREETTPVOL02.jpg?v=1779912073"},{"product_id":"lucky-devils-direct-market-exclusive-hardcover","title":"LUCKY DEVILS DIRECT MARKET EXCLUSIVE HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Charles Soule (A\/CA) Ryan Browne\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eA dark, hilarious satire about the struggle to do good in a world that makes it so easy to be bad, THE LUCKY DEVILS is an examination of everything that makes humanity both grand and terrible from two of comics' most unique storytellers. THE LUCKY DEVILS is a tale of two ordinary, good-hearted, 20-something Chicagoans who begin working with the devils on their shoulders in an attempt to fix their broken lives. It works beyond their wildest dreams, and in time they become two of the most powerful people on earth. While they fully intend to use that influence to make the world a better place, we all know what they say about the road to Hell… For fans of their previous bestselling collaborations like CURSE WORDS and EIGHT BILLION GENIES, stories like Lucifer or The Good Place, or tales where ordinary people's lives intersect with the supernatural—this new series is sure to delight readers looking for a fantastical new read. Collects THE LUCKY DEVILS #1-9.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781534334823\u003c\/span\u003e\u003cbr\u003ePage Count:    246\u003c\/p\u003e","brand":"Image Comics","offers":[{"title":"Default Title","offer_id":47859804012709,"sku":null,"price":53.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/No_Cover_Available_3f0301e4-1503-4d8a-af1d-e1c01b8661af.jpg?v=1771510017"},{"product_id":"honor-and-curse-eternal-vol-01-trade-paperback","title":"HONOR AND CURSE ETERNAL VOL 01 TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\n\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"returnability\"\u003e\u003c\/div\u003e\n\u003cdiv id=\"pcreators\"\u003e(W) Mark London (A) Jaime Infante (CA) Nick Marinkovich\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eAn immortal ninja cursed with a vengeful war spirit is forced out of hiding to protect the last descendants of his sworn family, even if it means unleashing the monster within. Six hundred years ago, shinobi warrior Genshi Sakagura was cursed to share his soul with a mythic spirit of war—the Tengu. Now immortal, he hides in modern-day New York, living in silence and penance, praying the curse stays buried. But when an ancient cult threatens the descendants of the family he swore to protect, Genshi must take up the blade again. To save them, he risks unleashing the monster inside—and becoming the very weapon the world fears most.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781545824276\u003c\/span\u003e\u003cbr\u003ePage Count:    104\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003ePage Count:    104\u003c\/p\u003e","brand":"Mad Cave Studios","offers":[{"title":"Default Title","offer_id":47861193244837,"sku":null,"price":24.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/HONORANDCURSEETERNALTPVOL01.jpg?v=1779977982"},{"product_id":"whatever-happened-to-the-crimson-justice-trade-paperback","title":"WHATEVER HAPPENED TO THE CRIMSON JUSTICE TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Frank Tieri (A\/CA) Inaki Miranda\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eJoin the Eisner-nominated team of Frank Tieri and Inaki Miranda (GODZILLA: HERE THERE BE DRAGONS, HARLEY QUINN, CATWOMAN) as they unravel the mystery of Whatever Happened to the Crimson Justice? in a story of heroes and villains—and the consequences of being either. There was a time when the Red Alert shone in the sky, and Empire City's greatest hero, the Crimson Justice, would answer the call. But now it's been years and neither he--nor his sidekick Reddy nor their psychotic arch foe, Dr Mayhem--have been seen since the Great Empire City Hospital Fire decades ago. What happened that fateful night? Did they all die? But if that's the case, who or what is this Dr Mayhem who's reappeared in the modern day, brutally murdering Commissioner Thomas Kent and challenging the Justice to return? Is that possible? Does the Crimson Justice still live? And if so, what could have made him disappear and abandon his crimson hood in the first place?\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781960578860\u003c\/span\u003e\u003cbr\u003ePage Count:    128\u003c\/p\u003e","brand":"Mad Cave Studios","offers":[{"title":"Default Title","offer_id":47861288698021,"sku":null,"price":24.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/WHATEVERHAPPENEDTOTHECRIMSONJUSTICETP.jpg?v=1779978682"},{"product_id":"carriers-vol-01-season-one-trade-paperback","title":"CARRIERS VOL 01 SEASON ONE TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Ben Ferrari, Erica J Heflin (A) Jim O'Riley (CA) Elias Martins\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eFable, Gladius, Cherrybomb, Dark Dove: no one has heard of these brave heroes ... yet ... but they are the only thing standing between the citizens of New York and the unseen terrors that lurk all around them. A band of weaponized carrier pigeons, they soar the night sky looking for new threats and find their largest one yet when the Croc King comes climbing up out of the New York sewer. Featuring five standalone high flying adventures!\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/29\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781954167216\u003c\/span\u003e\u003cbr\u003ePage Count:    168\u003c\/p\u003e","brand":"Massive Publishing","offers":[{"title":"Default Title","offer_id":47861292040357,"sku":null,"price":24.95,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/CARRIERSTPVOL01SEASONONE.jpg?v=1779978981"},{"product_id":"ec-epitaphs-from-the-abyss-book-one-library-edition-hardcover","title":"EC EPITAPHS FROM THE ABYSS BOOK ONE LIBRARY EDITION HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\n\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"returnability\"\u003e\u003c\/div\u003e\n\u003cdiv id=\"pcreators\"\u003e(W) Amy Roy, Brian Azzarello, Chris Condon, Christopher Cantwell (A) Alexandre Tefenkgi, Alison Sampson, Andrea Mutti, Andrea Sorrentino (CA) Lee Bermejo\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cspan\u003eA NEW ERA FOR THE MOST INFAMOUS AND INFLUENTIAL AMERICAN HORROR BRAND OF ALL TIME STARTS HERE IN ONE DEVILISHLY DELUXE HARDCOVER COLLECTION! After 70 years, EC Comics—the notorious comics publisher that spawned TALES FROM THE CRYPT, WEIRD SCIENCE, MAD magazine, and many more—rises from the grave with its first new series of the twenty-first century! For the first time in one comprehensive collection, join us for a guided tour of the Grave-Digger’s cemetery on the edge of the endless abyss . . . where EVERY TOMBSTONE TELLS A TALE . . . and the quickest way to etch your own is through MALEVOLENCE, MALICE, and MURDER! Collecting EC’s landmark resurrection in the pages of EPITAPHS FROM THE ABYSS #1–12 in one staggeringly deluxe, oversized (7.5 × 11.5) hardcover, this terrifying tome is positively brimming with depraved intention and traumatic tension as wrought by the hands (and snapped by the necks) of serial storytellers Jason Aaron (Thor), Brian Azzarello (Joker), Corinna Bechko (Green Lantern: Earth One), Chris Condon (Ultimate Wolverine), J. Holtham (The Horizon Experiment), and Matt Kindt (BRZRKR), and realized into bloody reality by 'all-slaughter' artists Charlie Adlard (The Walking Dead), Tyler Crook (Out of Alcatraz), Kano (Gotham Central), Klaus Janson (The Dark Knight Returns), Leomacs (Benjamin), Alison Sampson (Department of Truth), Andrea Sorrentino (Gideon Falls), and many more.  Plus: Gouge your eyes on 50 pages of 'behind-the-screams' material—including in-depth production art, character designs, and cover galleries—alongside all-new, exclusive commentaries from Eisner Award nominees Rian Hughes (The Multiversity) and Jay Stephens (Dwellings) on the painful (heh, heh) processes behind EC’s blockbuster rebirth. \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/07\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798894880846\u003c\/span\u003e\u003cbr\u003ePage Count:    416\u003c\/p\u003e","brand":"Oni Press","offers":[{"title":"Default Title","offer_id":47861324447909,"sku":null,"price":80.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/ECEPITAPHSFROMTHEABYSSHCBOOKONELIBRARYEDITION.jpg?v=1779980111"},{"product_id":"high-strangeness-deluxe-edition-hardcover","title":"HIGH STRANGENESS DELUXE EDITION HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Chris Condon, Christopher Cantwell, Zac Thompson (A) Dave Chisholm, Noah Bailey, Valeria Burzo, Christian Ward (CA) Jock\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eA startling new experiment in comic book storytelling inspired by firsthand accounts of real paranormal encounters . . . where overlapping phenomena like UFOs, hauntings, cryptid sightings, and inexplicable synchronicities seem to indicate a higher, unseen order of reality . . . Daniel Noah—writer, producer, director, and co-founder acclaimed production company SpectreVision— has documented and logged hundreds of otherworldly encounters spanning the super-spectrum of \"\"high strangeness\"\" that connects sightings of objects in the sky to haunted places and other perplexing manifestations that extend like fingers from a hidden hand. In High Strangeness, Noah leads an otherworldly cast of premier comics talents—including acclaimed writers Chris Condon (Ultimate Wolverine), Zac Thompson (Cemetery Kids Don't Die), Christopher Cantwell (Out of Alcatraz), Cecil Castellucci (EC's Cruel Universe), and Christian Ward (Batman: City of Madness), and dazzling artists Dave Chisholm (Plague House), Noah Bailey (Station Grand), Valeria Burzo (EC's Epitaphs from the Abyss), Chloé Stawski (Sapphic Pulp), and Christian Ward (The Ultimates)—across five decades of uncanny encounters at the dimly lit borderlands of human experience . . . that interlock to reveal an ambitious, dimension-spanning finale informed by Noah's own real-life glimpses of nonhuman intelligence. Collecting High Strangeness #1–5, this oversized deluxe hardcover volume also includes five nonfiction essays on the history and evidence underpinning the phenomena detailed in each chapter. Writers Chris Condon, Christopher Cantwell, Zac Thompson, Cecil Castellucci\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/15\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798894880884\u003c\/span\u003e\u003cbr\u003ePage Count:    240\u003c\/p\u003e","brand":"Oni Press","offers":[{"title":"Default Title","offer_id":47861338669221,"sku":null,"price":53.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/HIGHSTRANGENESSDELUXEEDITIONHC.jpg?v=1779980479"},{"product_id":"mighty-morphin-power-rangers-vol-1-compact-comics-edition","title":"MIGHTY MORPHIN POWER RANGERS VOL 1 COMPACT COMICS EDITION","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Kyle Higgins (A) Hendry Prasetya, Thony Silas, Jonathan Lam\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eDive into the electrifying beginning of the Mighty Morphin Power Rangers comic saga in an all-new way!\u003cbr\u003eWhen Tommy Oliver joins the team as the newly freed Green Ranger, he struggles to regain the trust of his fellow Rangers—and himself—while balancing the pressures of high school, new friendships, and the lingering influence of Rita Repulsa.\u003c\/p\u003e\n\u003cp\u003eIt’s not long before Rita enacts her boldest plan for global domination yet and the Rangers face a devastating new threat with the mysterious Black Dragon! Together they stand a chance, but the stakes are about to get higher as Billy and Tommy become unexpectedly pulled into a mysterious new dimension with no way home! Can the team rally together to save not only Angel Grove…but the entire world?\u003c\/p\u003e\n\u003cp\u003eCollecting the first three story arcs of the smash-hit series by writer Kyle Higgins and illustrator Hendry Prasetya, this all-new compact edition is perfect for fans of all ages to enjoy the groundbreaking series in its most accessible format yet!\u003c\/p\u003e\n\u003cp\u003eCollects Mighty Morphin Power Rangers #0-12.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798217383801\u003c\/span\u003e\u003cbr\u003ePage Count:    288\u003c\/p\u003e","brand":"BOOM! Studios","offers":[{"title":"Default Title","offer_id":47861474984101,"sku":null,"price":19.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/MIGHTYMORPHINPOWERRANGERSVOL1COMPACTCOMICSEDITION.jpg?v=1779984249"},{"product_id":"minor-arcana-book-one-deluxe-edition-hardcover","title":"MINOR ARCANA BOOK ONE DELUXE EDITION HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Jeff Lemire (A) Jeff Lemire, Letizia Cadonici\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eNew York Times–bestselling and award-winning cartoonist Jeff Lemire’s first solo longform project since Sweet Tooth, now remastered into a deluxe format!\u003cbr\u003eTheresa’s mother has fallen ill, and as a young bitter misanthrope, returning to her hometown to take care of her phony psychic of a mom is the last thing on Theresa’s bucket list. But when Theresa finds out these abilities might be real after all, it will be up to her to reconcile with her ailing mother, confront the failures of her past, and help the townsfolk she’d spent her life running from not so long ago…\u003c\/p\u003e\n\u003cp\u003eFrom New York Times–bestselling and award-winning cartoonist Jeff Lemire comes a profoundly intimate and supernatural meditation on family, grief, community, and the invisible threads that pull us home. Now for the first time ever, the full three arcs of this heartfelt journey are available in a complete, deluxe hardcover that underscores the series’ prestige storytelling.\u003cbr\u003eCollects Minor Arcana #1-15.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798217383818\u003c\/span\u003e\u003cbr\u003ePage Count:    400\u003c\/p\u003e","brand":"BOOM! Studios","offers":[{"title":"Default Title","offer_id":47861565522085,"sku":null,"price":65.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/MINORARCANABOOKONEDELUXEEDITION.jpg?v=1779985041"},{"product_id":"the-dc-universe-by-keith-giffen-hardcover","title":"THE DC UNIVERSE BY KEITH GIFFEN HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Keith Giffen (A) Keith Giffen\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eThe DC Universe by Keith Giffen Omnibus is a sweeping celebration of one of comics’ most inventive, fearless, and genre-defying creators. From universe-spanning sagas to razor-sharp satire, from irreverent cult favorites to foundational reinventions of DC icons, this volume captures Giffen’s impact across decades.\u003cbr\u003eHow do you define the life’s work of one of the most imaginative and irreverent comics creators ever? We don’t know either, but we’re giving it a shot with this volume collecting a plethora of Keith Giffen stories plucked from the pages of Legion of Substitute Heroes Special #1, Legion of Super-Heroes (1989) #1, Justice League America #45, Justice League #5, Secret Origins #34, Lobo Paramilitary Christmas Special #1, The Big Book of Urban Legends #1, Blue Beetle #1, 52 #17, Ambush Bug #1-4, and for the first time ever, The Heckler #1-6, restored in full color!\u003c\/p\u003e\n\u003cp\u003eFeaturing a foreword from J.M. DeMatteis, we hope this strange tome makes you laugh, cry, laugh some more, become confused, and be entertained by the one and only Keith Giffen.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781799509103\u003c\/span\u003e\u003cbr\u003ePage Count:    448\u003c\/p\u003e","brand":"DC Comics","offers":[{"title":"Default Title","offer_id":47861634236581,"sku":null,"price":65.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/THEDCUNIVERSEBYKEITHGIFFENHARDCOVER.jpg?v=1779986229"},{"product_id":"hellboy-universe-the-secret-histories-vol-2-hardcover","title":"HELLBOY UNIVERSE THE SECRET HISTORIES VOL 2 HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Mike Mignola, Chris Roberson (A) Christopher Mitten, Leila Del Duca, Andrea Mutti\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eFour stories of fascinating side characters are explored in full, collected in this second volume of standalone comics stories perfect for any Hellboy fan's library.\u003cbr\u003eBefore the Black Flame threatened the B.P.R.D.—and the world—what was the source of his power? Who was Hellboy’s Uncle Simon, and what occult mysteries did he and the Silver Lantern Club investigate? Can Silver Lantern Club member and detective Sarah Jewell find the killer in a locked-room murder mystery before she becomes a victim herself? And in an idyllic British town that holds unusual traditions, could the village’s history be linked to larger and more significant events than they could even know? Dive into these paranormal secrets, collected in this second volume of standalone stories perfect for any Hellboy fan's library.\u003c\/p\u003e\n\u003cp\u003eHellboy creator Mike Mignola is joined by writer Chris Roberson and artists Christopher Mitten, Leila del Duca, Andrea Mutti, Ben Stenbeck, and others to bring these mysteries of the Hellboy universe to light.\u003c\/p\u003e\n\u003cp\u003eCollects Rise of the Black Flame #1–#5, The House of Lost Horizons #1–#5, British Paranormal Society: Time Out of Mind #1–#4, Hellboy: The Silver Lantern Club #1–#5, and bonus material.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506754703\u003c\/span\u003e\u003cbr\u003ePage Count:    512\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47862012805285,"sku":null,"price":53.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/HELLBOYUNIVERSETHESECRETHISTORIESVOL2HARDCOVER.jpg?v=1779997314"},{"product_id":"masterminds-trade-paperback","title":"MASTERMINDS TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Zack Kaplan (A) Stephen Thompson, Thiago Rocha\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eAuthor Zack Kaplan and artist Stephen Thompson team up again to create an enigmatic comics thriller tangled in a secret society.\u003cbr\u003eWhen an ambitious and troubled video game programmer dares to audition for a secret society in the gaming\/tech industry, composed of cutthroat, genius masterminds that promise to help their members achieve their wildest dreams, he and his rebellious co-worker find themselves in a gauntlet of real-life puzzles that quickly turn deadly. But in order to win, they must solve the dangerous challenges, unlock the group’s true motives and unveil the real architect of this ordeal. Are they truly smart enough to survive the mysterious game of the Masterminds?\u003c\/p\u003e\n\u003cp\u003eAuthor Zack Kaplan (Kill All Immortals, Port of Earth) and illustrator Stephen Thomson (Aliens: Definace, Black Panther and the Crew), the creative team behind The Midnight: Shadows, join forces with colorist Thiago Rocha and Eisner award-winning letterer Hassan Otsmane-Elhaou to bring you an enigmatic thriller for the age of tech industry omniscience.\u003c\/p\u003e\n\u003cp\u003eCollects Masterminds #1–#5.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    10\/20\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506752594\u003c\/span\u003e\u003cbr\u003ePage Count:    144\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47862020833445,"sku":null,"price":25.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/MASTERMINDSTRADEPAPERBACK.jpg?v=1779997815"},{"product_id":"minor-threats-vol-3-the-last-devil-left-alive-trade-paperback","title":"MINOR THREATS VOL 3 THE LAST DEVIL LEFT ALIVE TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Patton Oswalt, Jordan Blum (A) Scott Hepburn\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eThe hit superhero comics saga that’s Watchmen meets The Wire returns from Patton Oswalt and Jordan Blum, showrunners of Marvel’s M.O.D.O.K. on HULU, and superstar artist Scott Hepburn (Tom Morello’s Orchid).\u003cbr\u003eFrankie Follis a.k.a the supervillain Playtime has hit rock bottom.\u003c\/p\u003e\n\u003cp\u003eHer criminal empire was left in ruins after her ex-lover, Scalpel’s, betrayal. The secret deal she cut with the superhero team The Continuum was exposed along with her secret identity—forcing Frankie to flee, disappearing off the grid. \u003c\/p\u003e\n\u003cp\u003eThree years later she's resurfaced, recruiting friend and foe alike to help her uncover a secret that threatens Twilight City. Grab your freezeguns and power gauntlets, it's time to join the underground!\u003c\/p\u003e\n\u003cp\u003eCollects Minor Threats: The Last Devil Left Alive #1–#5.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/17\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506747330\u003c\/span\u003e\u003cbr\u003ePage Count:    152\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47866728022181,"sku":null,"price":25.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/MINORTHREATSVOL3THELASTDEVILLEFTALIVETRADEPAPERBACK.jpg?v=1780151440"},{"product_id":"star-wars-galactic-tales-of-terror-library-edition-hardcover","title":"STAR WARS GALACTIC TALES OF TERROR LIBRARY EDITION HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Cavan Scott (A) Soo Lee, Vincenzo Riccardi, Fico Ossio, Nick Brokenshire\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eShiver at these terrifying tales from a galaxy far, far away….\u003c\/p\u003e\n\u003cp\u003eThree anthologies of spooky Star Wars comics stories are collected in this one deluxe hardcover edition!\u003cbr\u003eDeep in the Outer Rim, far from the light of the Jedi, strange creatures trade chilling stories that would terrify even the cruelest Sith Lord!\u003c\/p\u003e\n\u003cp\u003eAs the twin suns set over Tatooine, Captain Vaclav finds himself dangling above Jabba the Hutt’s rancor pit! To bargain for his freedom, Vaclav regales the crime boss with three blood-curdling tales of phantom droids, alien lycanthropes, and ice-planet serpents! Is it possible to scare the cold-hearted Hutt?\u003c\/p\u003e\n\u003cp\u003eOn the dark and stormy coast of Kef Bir, a cloaked figure warns a young maverick named Fry about the horrors that lurk in the ruins of the Death Star: trash compactor terrors, ghostly pilots, and Imperial zombies! Will Fry heed the warning?\u003c\/p\u003e\n\u003cp\u003eAnd during long nights on Ryloth, Twi’leks speak in hushed tones about the Nightlander. This shadowy entity haunts three generations of legendary heroes in its quest to bring despair to the galaxy! How will Anakin, Luke, Leia, and Rey quell this dark power unlike any other?  \u003c\/p\u003e\n\u003cp\u003eWritten by master of the macabre Cavan Scott, the New York Times bestselling author of Star Wars Adventures: Tales from Vader’s Castle, and rendered in ghastly detail by award-winning illustrators, including Soo Lee, Nick Brokenshire, Vincenzo Riccardi, Fico Ossio, and more!\u003c\/p\u003e\n\u003cp\u003eCollects Star Wars: Tales from the Rancor Pit, Star Wars: Tales from the Death Star, and Star Wars: Tales from the Nightlands #1–#3 in a deluxe, oversized library edition!\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506751467\u003c\/span\u003e\u003cbr\u003ePage Count:    240\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47866746273957,"sku":null,"price":78.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/STARWARSGALACTICTALESOFTERRORLIBRARYEDITIONHARDCOVER.jpg?v=1780152153"},{"product_id":"the-black-beetle-omnibus-trade-paperback","title":"THE BLACK BEETLE OMNIBUS TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W)  Francesco Francavilla\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eFRANCESCO FRANCAVILLA’S BLACK BEETLE RETURNS—IN A STUNNING GRAPHIC NOVEL OMNIBUS CELEBRATION OF PULP, PERIL, AND PURE STYLE!\u003cbr\u003eFrom the mind and pen of Eisner Award–winning author Francesco Francavilla comes the complete saga of the mysterious masked crime-fighter who stalks the shadows of Colt City—The Black Beetle!\u003c\/p\u003e\n\u003cp\u003eNow, for the first time ever, every thrilling tale of The Black Beetle from Dark Horse Comics is collected in one deluxe omnibus, featuring:\u003c\/p\u003e\n\u003cp\u003eThe pulse-pounding full-length adventures No Way Out and Kara Böcek.\u003cbr\u003eThe moody, hard-hitting one-shot Night Shift.\u003cbr\u003eA treasure trove of never-before-seen bonus content including concept art, layouts, character studies, vintage-style lobby cards, and behind-the-scenes material straight from Francavilla’s sketchbook.\u003cbr\u003ePlus: An all-new painted cover by Francesco Francavilla, created exclusively for this volume!\u003c\/p\u003e\n\u003cp\u003eWith its intoxicating blend of pulp noir, supernatural intrigue, and explosive action, The Black Beetle is a love letter to classic crimebusters—and a masterclass in visual storytelling. \u003c\/p\u003e\n\u003cp\u003eStep into the shadows. Fight for justice. Discover the legend. Perfect for longtime fans and newcomers alike—this is the definitive Black Beetle collection.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506755038\u003c\/span\u003e\u003cbr\u003ePage Count:    216\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47866756464805,"sku":null,"price":39.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/THEBLACKBEETLEOMNIBUSTRADEPAPERBACK.jpg?v=1780153616"},{"product_id":"the-ec-archives-the-complete-piracy-trade-paperback","title":"THE EC ARCHIVES THE COMPLETE PIRACY TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Carl Wessler, Al Feldstein (A) Graham Ingels, Bernie Krigstein, George Evans\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eTENSE TALES FROM THE SEVEN SEAS!\u003cbr\u003eCollecting the complete run of the EC Comics cult classic Piracy in an affordable oversized paperback, and featuring stories about the violence and cruelty of the pirates that sailed the seven seas. Across these pages sail plunderers, pillagers, buccaneers, whalers, smugglers, pearl divers, treasure hunters, mutineers, and many more, in these brutal tales of life on the water.\u003c\/p\u003e\n\u003cp\u003eCollects Piracy #1–#7.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/22\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781506754161\u003c\/span\u003e\u003cbr\u003ePage Count:    232\u003c\/p\u003e","brand":"Dark Horse","offers":[{"title":"Default Title","offer_id":47866756726949,"sku":null,"price":25.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/THEECARCHIVESTHECOMPLETEPIRACYTRADEPAPERBACK.jpg?v=1780153761"},{"product_id":"beneath-the-trees-where-nobody-sees-artists-edition-hardcover","title":"BENEATH THE TREES WHERE NOBODY SEES ARTIST'S EDITION HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Patrick Horvath\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eEvery page of the groundbreaking indie-sensation comic series, scanned from Patrick Horvath’s original paintings and presented like never before in one magnificent collection!\u003cbr\u003eIn fall 2023, Patrick Horvath and IDW Publishing released the first issue of Beneath the Trees Where Nobody Sees into the world. With its unique blend of beautiful watercolor art and shocking subject matter, it instantly lit the comic-book-reading world on fire and is one of the most popular original comic series of the last decade. Readers were captivated by the story of anthropomorphic serial-killer bear Samantha Strong and couldn’t spend enough time in the beautifully rendered town of Woodbrook. \u003c\/p\u003e\n\u003cp\u003eThis glorious collection features every single page from the first series and the 10-page short story \"Praludium,\" all presented for the very first time exactly as Horvath painted them. Full size. No digital adjustments. Experience the full force of the art that became this decade’s biggest comics sensation. Also included are six clear overlay pages that showcase patch panels, enabling you to see the original art and the final art as it was published!\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/28\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798887244488\u003c\/span\u003e\u003cbr\u003ePage Count:    168\u003c\/p\u003e","brand":"IDW Publishing","offers":[{"title":"Default Title","offer_id":47866757578917,"sku":null,"price":195.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/BENEATHTHETREESWHERENOBODYSEESARTIST_SEDITIONHARDCOVER.jpg?v=1780154036"},{"product_id":"event-horizon-dark-descent-trade-paperback","title":"EVENT HORIZON DARK DESCENT TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Christian Ward (A) Tristan Jones\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eDiscover what happened to the original crew of the Event Horizon in this all-new cosmic horror graphic novel set in the universe of the terrifying cult-classic film!\u003cbr\u003eThis original comic series serves as an official prequel to the film! The Event Horizon was a revolutionary spaceship designed for one mission: faster-than-light travel with a top-secret, experimental gravity drive. But upon activating the device, the ship journeyed across the borders of Hell itself. In a nightmarish realm of torments beyond imagining, Captain Kilpack and the crew of the Event Horizon must resist all manner of demonic forces—including Paimon, the eyeless King of Hell, and their own descents into madness and bloodlust—if they’ve any chance of escaping back to their own world.\u003c\/p\u003e\n\u003cp\u003eAbandon all hope and board the Event Horizon with multiple Eisner Award winner Christian Ward (writer of Batman: City of Madness, Two-Face) and powerhouse sci-fi artist Tristan Jones (Aliens: Defiance, Tales of the TMNT) in this unbelievable story of the true and final fate of the original Event Horizon crew.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    07\/28\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798887244495\u003c\/span\u003e\u003cbr\u003ePage Count:    128\u003c\/p\u003e","brand":"IDW Publishing","offers":[{"title":"Default Title","offer_id":47866757939365,"sku":null,"price":26.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/EVENTHORIZONDARKDESCENTTRADEPAPERBACK.jpg?v=1780154158"},{"product_id":"teenage-mutant-ninja-turtles-ujigami-trade-paperback","title":"TEENAGE MUTANT NINJA TURTLES UJIGAMI TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Gene Luen Yang (A) Freddie E. Williams II, Fero Pe\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eMaster Splinter has mysteriously returned from the dead, but he has come back…wrong. The Turtles must fight to save their father before tragedy strikes!\u003cbr\u003eFollowing Jason Aaron and Juan Ferreyra’s acclaimed run, Gene Luen Yang and Freddie E. Williams II take the helm!\u003c\/p\u003e\n\u003cp\u003eMaster Splinter has returned from the dead! However, the Turtles have little time to enjoy their family reunion, as a new masked killer, the Ujigami, has begun assassinating the Turtles’ enemies. Things only go from bad to worse when the Turtles discover that Master Splinter and the Ujigami are one and the same! The brothers must discover what is wrong with their father and find a solution before dark forces, led by the mystical witch Shinigami (making her IDW debut), take their father from them again!\u003c\/p\u003e\n\u003cp\u003eThis third volume of the new ongoing Teenage Mutant Ninja Turtles series from IDW collects issues #13–18.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/24\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798887245102\u003c\/span\u003e\u003cbr\u003ePage Count:    160\u003c\/p\u003e","brand":"IDW Publishing","offers":[{"title":"Default Title","offer_id":47866786578597,"sku":null,"price":26.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/TEENAGEMUTANTNINJATURTLESUJIGAMITRADEPAPERBACK.jpg?v=1780156173"},{"product_id":"teenage-mutant-ninja-turtles-ujigami-direct-market-trade-paperback","title":"TEENAGE MUTANT NINJA TURTLES UJIGAMI DIRECT MARKET TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Jason Aaron, Gene Luen Yang (A) Juan Ferreyra, Fero Pe, Freddie E. Williams II\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eMaster Splinter has mysteriously returned from the dead, but he has come back…wrong. The Turtles must fight to save their father before tragedy strikes!\u003cbr\u003eFollowing Jason Aaron and Juan Ferreyra’s acclaimed run, Gene Luen Yang and Freddie E. Williams II take the helm!\u003c\/p\u003e\n\u003cp\u003eMaster Splinter has returned from the dead! However, the Turtles have little time to enjoy their family reunion, as a new masked killer, the Ujigami, has begun assassinating the Turtles’ enemies. Things only go from bad to worse when the Turtles discover that Master Splinter and the Ujigami are one and the same! The brothers must discover what is wrong with their father and find a solution before dark forces, led by the mystical witch Shinigami (making her IDW debut), take their father from them again!\u003c\/p\u003e\n\u003cp\u003eThis third volume of the new ongoing Teenage Mutant Ninja Turtles series from IDW collects issues #13–18.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    11\/24\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9798887242255\u003c\/span\u003e\u003cbr\u003ePage Count:    160\u003c\/p\u003e","brand":"IDW Publishing","offers":[{"title":"Default Title","offer_id":47866786775205,"sku":null,"price":26.99,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/TEENAGEMUTANTNINJATURTLESUJIGAMIDIRECTMARKETTRADEPAPERBACK.jpg?v=1780156338"},{"product_id":"fantastic-four-by-dan-slott-omnibus-vol-2-direct-market-cafu-cvr-hardcover","title":"FANTASTIC FOUR BY DAN SLOTT OMNIBUS VOL 2 DIRECT MARKET CAFU CVR HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Dan Slott, Christopher Cantwell (A) R.B. Silva, Ze Carlos (CA) Cafu\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eDan Slott concludes his run with the cosmic epic he's waited years to tell! A new era begins with new uniforms and a major status-quo change, but who is the mysterious figure called the Helmsman? Is he here to save our reality or destroy it? One of the most important characters in the Marvel Universe returns from the dead! When the King in Black plunges the world into darkness, symbiotes will bond with two of the FF! And you are cordially commanded to Latveria for the royal wedding of Doctor Doom! But why is Mister Fantastic acting as best man? And how will the nuptials profoundly change the Human Torch's life? Meanwhile, Kang's entire bloodline is out to destroy every era of the Fantastic Four! And when the greatest conflict to ever rage across the Multiverse is reignited, the FF and an incredible cast of allies must survive the Reckoning War! Collecting FANTASTIC FOUR (2018) #25-48, FANTASTIC FOUR: RECKONING WAR ALPHA (2022), RECKONING WAR: TRIAL OF THE WATCHER (2022) and FANTASTIC FOUR: ROAD TRIP (2020).\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    12\/01\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302961237\u003c\/span\u003e\u003cbr\u003ePage Count:    784\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866832519333,"sku":null,"price":125.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/FANTASTICFOURBYDANSLOTTOMNIBUSVOL2DIRECTMARKETCAFUCVRHARDCOVER.jpg?v=1780160235"},{"product_id":"fantastic-four-by-dan-slott-omnibus-vol-2-mark-brooks-cvr-hardcover","title":"FANTASTIC FOUR BY DAN SLOTT OMNIBUS VOL 2 MARK BROOKS CVR HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Dan Slott, Christopher Cantwell (A) R.B. Silva, Ze Carlos (CA) Mark Brooks\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eDan Slott concludes his run with the cosmic epic he's waited years to tell! A new era begins with new uniforms and a major status-quo change, but who is the mysterious figure called the Helmsman? Is he here to save our reality or destroy it? One of the most important characters in the Marvel Universe returns from the dead! When the King in Black plunges the world into darkness, symbiotes will bond with two of the FF! And you are cordially commanded to Latveria for the royal wedding of Doctor Doom! But why is Mister Fantastic acting as best man? And how will the nuptials profoundly change the Human Torch's life? Meanwhile, Kang's entire bloodline is out to destroy every era of the Fantastic Four! And when the greatest conflict to ever rage across the Multiverse is reignited, the FF and an incredible cast of allies must survive the Reckoning War! Collecting FANTASTIC FOUR (2018) #25-48, FANTASTIC FOUR: RECKONING WAR ALPHA (2022), RECKONING WAR: TRIAL OF THE WATCHER (2022) and FANTASTIC FOUR: ROAD TRIP (2020).\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    12\/01\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302961220\u003c\/span\u003e\u003cbr\u003ePage Count:    784\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866832781477,"sku":null,"price":125.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/FANTASTICFOURBYDANSLOTTOMNIBUSVOL2MARKBROOKSCVRHARDCOVER.jpg?v=1780160499"},{"product_id":"fantastic-four-vol-2-the-invincible-woman-trade-paperback","title":"FANTASTIC FOUR VOL 2 THE INVINCIBLE WOMAN TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Ryan North (A) Humberto Ramos, Patrick Boutin, Stan Sakai (CA) Humberto Ramos\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eThe Fantastic Four face the malice of…the Invincible Woman!\u003cbr\u003eExtremophile aliens have invaded Earth! Their plan: stop the planet’s rotation so the same side always faces the sun – and then colonize that boiling, deadly side for themselves. Only the Fantastic Four can save Earth from destruction! But none of their powers involve altering the Earth’s rotation – or do they? And when the Wizard takes advantage of the chaos to attack the Baxter Building, there may be more going on here than meets the eye – including a discovery that’ll change the Fantastic Four’s fate forever! With a message hidden in the structure of the reality itself decoded, Sue Storm will become the most wanted woman in the universe! Solving this mystery, the FF will voyage into new and unknown parts of the cosmos to save Galactus – only to find ruin at the hands of the Invincible Woman! As she sets her sights on Earth, will anyone survive? And at what cost?! Plus: The beginnings of the all-new Future Foundation! And an FF tale from the legendary Stan Sakai!\u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Fantastic Four (2025) #6-11.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/01\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302963385\u003c\/span\u003e\u003cbr\u003ePage Count:    144\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866835337381,"sku":null,"price":25.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/FANTASTICFOURVOL2THEINVINCIBLEWOMANTRADEPAPERBACK.jpg?v=1780160675"},{"product_id":"iron-man-demon-in-a-bottle-epic-collection-trade-paperback","title":"IRON MAN DEMON IN A BOTTLE EPIC COLLECTION TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) David Michelinie, Bob Layton (A) John Romita Jr., Bob Layton (CA) Bob Layton\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eThe trio of David Michelinie, Bob Layton and John Romita Jr. make comics history in this iconic run!\u003cbr\u003eA new era begins for Iron Man — and for comics! Visionary creators Bob Layton, David Michelinie and John Romita Jr. launch a character-defining run that proves Tony Stark is far more than a technological genius. Stark’s true strength shines through perseverance in the face of personal demons and relentless enemies. This groundbreaking era also introduces a dynamic new cast — including Jim Rhodes, the future War Machine — and showcases bold new Iron Man armors. While the Michelinie\/Layton\/Romita Jr. collaboration reaches its emotional peak with “Demon in a Bottle,” the saga soars even further with epic clashes against Titanium Man, the All-Devourer and Madame Masque! Guest-starring the Hulk in a three-issue conflict between armor and raw power!\u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Iron Man (1968) #115-139\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/01\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302967444\u003c\/span\u003e\u003cbr\u003ePage Count:    480\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866836910245,"sku":null,"price":68.75,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/IRONMANDEMONINABOTTLEEPICCOLLECTIONTRADEPAPERBACK.jpg?v=1780161319"},{"product_id":"ultimate-spider-man-omnibus-vol-2-new-printing-direct-market-cassaday-cvr-hardcover","title":"ULTIMATE SPIDER-MAN OMNIBUS VOL 2 NEW PRINTING DIRECT MARKET CASSADAY CVR HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Brian Michael Bendis (A) Mark Bagley, Joe Quesada, Trevor Hairsine (CA) John Cassaday\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eBrian Michael Bendis and Mark Bagley continue their sensational, 21st century reimagining of the world's greatest super hero!\u003cbr\u003eAs life gets ever more complicated for Peter Parker, Spider-Man faces off against an explosive new teenage villain, has another run-in with the infamous Kingpin of Crime and meets the Black Cat - a jewel thief who will complicate Spidey's career and Peter's love life! But nothing can prepare him for the moment that the Green Goblin, Doctor Octopus, Electro, Kraven the Hunter and Sandman unite. That's five of Spider-Man's deadliest foes - so who will be the final member of the Ultimate Six?! Plus: Peter goes Hollywood for Spider-Man: The Movie! Spidey teams up with Wolverine and the Human Torch! And prepare for the Ultimate Universe's shocking version of Carnage! \u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Ultimate Spider-Man (2000) #40-71 and Ultimate Six #1-7.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    08\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302970673\u003c\/span\u003e\u003cbr\u003ePage Count:    984\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866861125797,"sku":null,"price":156.25,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/ULTIMATESPIDER-MANOMNIBUSVOL2NEWPRINTINGDIRECTMARKETCASSADAYCVRHARDCOVER.jpg?v=1780163384"},{"product_id":"ultimate-spider-man-omnibus-vol-2-new-printing-direct-market-bagley-cvr-hardcover-copy","title":"ULTIMATE SPIDER-MAN OMNIBUS VOL 2 NEW PRINTING DIRECT MARKET BAGLEY CVR HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Brian Michael Bendis (A) Mark Bagley, Joe Quesada, Trevor Hairsine (CA) Mark Bagley\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eBrian Michael Bendis and Mark Bagley continue their sensational, 21st century reimagining of the world's greatest super hero!\u003cbr\u003eAs life gets ever more complicated for Peter Parker, Spider-Man faces off against an explosive new teenage villain, has another run-in with the infamous Kingpin of Crime and meets the Black Cat - a jewel thief who will complicate Spidey's career and Peter's love life! But nothing can prepare him for the moment that the Green Goblin, Doctor Octopus, Electro, Kraven the Hunter and Sandman unite. That's five of Spider-Man's deadliest foes - so who will be the final member of the Ultimate Six?! Plus: Peter goes Hollywood for Spider-Man: The Movie! Spidey teams up with Wolverine and the Human Torch! And prepare for the Ultimate Universe's shocking version of Carnage! \u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Ultimate Spider-Man (2000) #40-71 and Ultimate Six #1-7.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    08\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302970666\u003c\/span\u003e\u003cbr\u003ePage Count:    984\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866861879461,"sku":null,"price":156.25,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/ULTIMATESPIDER-MANOMNIBUSVOL2NEWPRINTINGDIRECTMARKETBAGLEYCVRHARDCOVER_Copy.jpg?v=1780163558"},{"product_id":"ultimate-spider-man-omnibus-vol-2-new-printing-bagley-50th-issue-cvr-hardcover","title":"ULTIMATE SPIDER-MAN OMNIBUS VOL 2 NEW PRINTING BAGLEY 50TH ISSUE CVR HARDCOVER","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Brian Michael Bendis (A) Mark Bagley, Joe Quesada, Trevor Hairsine (CA) Mark Bagley\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eBrian Michael Bendis and Mark Bagley continue their sensational, 21st century reimagining of the world's greatest super hero!\u003cbr\u003eAs life gets ever more complicated for Peter Parker, Spider-Man faces off against an explosive new teenage villain, has another run-in with the infamous Kingpin of Crime and meets the Black Cat - a jewel thief who will complicate Spidey's career and Peter's love life! But nothing can prepare him for the moment that the Green Goblin, Doctor Octopus, Electro, Kraven the Hunter and Sandman unite. That's five of Spider-Man's deadliest foes - so who will be the final member of the Ultimate Six?! Plus: Peter goes Hollywood for Spider-Man: The Movie! Spidey teams up with Wolverine and the Human Torch! And prepare for the Ultimate Universe's shocking version of Carnage! \u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Ultimate Spider-Man (2000) #40-71 and Ultimate Six #1-7.\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    08\/04\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302970659\u003c\/span\u003e\u003cbr\u003ePage Count:    984\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866862010533,"sku":null,"price":156.25,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/ULTIMATESPIDER-MANOMNIBUSVOL2NEWPRINTINGBAGLEY50THISSUECVRHARDCOVER.jpg?v=1780163629"},{"product_id":"ultimate-wolverine-vol-3-the-makers-mark-trade-paperback","title":"ULTIMATE WOLVERINE VOL 3 THE MAKER'S MARK TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Christopher Condon (A) Alessandro Cappuccio, Domenico Carbone (CA) Alessandro Cappuccio\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eWolverine slashes his way into the Maker’s war!\u003cbr\u003eWolverine is hunting down the Maker’s Council – and with the Maker himself on the horizon, it’s time to exact revenge on the ones who turned his life into a living nightmare! Meanwhile, the search for the missing mutants takes a terrifying turn when Wolverine and Jean Grey discover that the captives may be trapped in Magik’s Limbo realm! Their mission to find Illyana leads them straight into a brutal battle with the Eurasian Republic’s forces – including the devastating Lady Deathstrike! To escape Illyana’s domain of dark magic, a final sacrifice must be made!\u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Ultimate Wolverine (2025) #13-16 And Material From Ultimate Universe: Finale (2026).\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/01\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302968120\u003c\/span\u003e\u003cbr\u003ePage Count:    112\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866877345957,"sku":null,"price":20.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/ULTIMATEWOLVERINEVOL3THEMAKER_SMARKTRADEPAPERBACK.jpg?v=1780164314"},{"product_id":"ultimates-gods-and-monsters-epic-collection-trade-paperback","title":"ULTIMATES GODS AND MONSTERS EPIC COLLECTION TRADE PAPERBACK","description":"\u003cdiv class=\"content\"\u003e\n\u003cdiv id=\"pcreators\"\u003e\u003cspan\u003e(W) Mark Millar (A) Bryan Hitch, Steve Dillon (CA) Bryan Hitch\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003eThe concluding volume of Millar and Hitch’s hugely influential epic!\u003cbr\u003eThey are the greatest heroes the world has ever known: Captain America, Iron Man, Thor, Hulk, Wasp, Giant Man, Hawkeye, Black Widow, Quicksilver and Scarlet Witch. They’ve saved the world from alien invasion, becoming international celebrities and America’s champions — but now all that’s about to change. Can the Ultimates survive the Hulk’s execution, Thor’s imprisonment and the advent of the Defenders?! On the eve of Tony and Natasha’s wedding, Nick Fury makes his move against the mysterious traitor who’s been plaguing the team — and the Ultimates will never be the same! The world’s greatest heroes are in for the battle of the century, and not all of them will be walking away. \u003c\/p\u003e\n\u003cp\u003eCOLLECTING: Ultimates 2 (2004) #1-13, Ultimates Annual (2005) #1\u003c\/p\u003e\n\u003cp\u003eFOC Date:    06\u003cspan\u003e\/20\/2026\u003c\/span\u003e\u003cbr\u003eIn-Store Date:    09\/01\/2026\u003cbr\u003eISBN:    \u003cspan\u003e9781302969370\u003c\/span\u003e\u003cbr\u003ePage Count:    488\u003c\/p\u003e","brand":"Marvel","offers":[{"title":"Default Title","offer_id":47866878230693,"sku":null,"price":68.75,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/files\/ULTIMATESGODSANDMONSTERSEPICCOLLECTIONTRADEPAPERBACK.jpg?v=1780164536"}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0747\/0465\/0405\/collections\/Gemini_Generated_Image_h8x8qnh8x8qnh8x8_3258a591-3100-4e87-adc9-c719da533508.png?v=1779894989","url":"https:\/\/planet42comics.com\/collections\/preorders-book-06-20-2026.oembed?page=2","provider":"Planet 42 Comics","version":"1.0","type":"link"}